WFDC5 Antibody

Name WFDC5 Antibody
Supplier Novus Biologicals
Catalog NBP1-57932
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to WFDC5(WAP four-disulfide core domain 5) The peptide sequence was selected from the N terminal of WFDC5. Peptide sequence MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene WFDC5
Conjugate Unconjugated
Supplier Page Shop

Product images