TP53TG5 Antibody
| Name | TP53TG5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58923 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | Synthetic peptides corresponding to C20ORF10 The peptide sequence was selected from the N terminal of C20ORF10. Peptide sequence RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TP53TG5 |
| Supplier Page | Shop |
Product images
![Western Blot: TP53TG5 Antibody [NBP1-58923] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/3859_TP53TG5%2520Antibody-Western%2520Blot-NBP1-58923-img0002.jpg)
Western Blot: TP53TG5 Antibody [NBP1-58923] - 721_B cell lysate, concentration 0.2-1 ug/ml.