RAB40A Antibody

Name RAB40A Antibody
Supplier Novus Biologicals
Catalog NBP1-58921
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAB40A(RAB40A, member RAS oncogene family) The peptide sequence was selected from the middle region of RAB40A. Peptide sequence RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB40A
Conjugate Unconjugated
Supplier Page Shop

Product images