RAB39B Antibody

Name RAB39B Antibody
Supplier Novus Biologicals
Catalog NBP1-58900
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RAB39B(RAB39B, member RAS oncogene family) The peptide sequence was selected from the N terminal of RAB39B. Peptide sequence MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAB39B
Conjugate Unconjugated
Supplier Page Shop

Product images