CSHL1 Antibody

Name CSHL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59312
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to CSHL1(chorionic somatomammotropin hormone-like 1) The peptide sequence was selected from the C terminal of CSHL1. Peptide sequence GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CSHL1
Supplier Page Shop

Product images