Name | CSHL1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59312 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Dog, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to CSHL1(chorionic somatomammotropin hormone-like 1) The peptide sequence was selected from the C terminal of CSHL1. Peptide sequence GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CSHL1 |
Supplier Page | Shop |