Placental Lactogen/CSH1 Antibody
| Name | Placental Lactogen/CSH1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59302 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CSH1 (chorionic somatomammotropin hormone 1 (placental lactogen)) The peptide sequence was selected from the middle region of CSH1. Peptide sequence SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CSH1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Placental Lactogen/CSH1 Antibody [NBP1-59302] - Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24902_Placental-Lactogen-CSH1-Antibody-Western-Blot-NBP1-59302-img0001.jpg)
Western Blot: Placental Lactogen/CSH1 Antibody [NBP1-59302] - Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: Human Placenta
![Immunohistochemistry-Paraffin: Placental Lactogen/CSH1 Antibody [NBP1-59302] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24903_Placental-Lactogen-CSH1-Antibody-Immunohistochemistry-Paraffin-NBP1-59302-img0002.jpg)
Immunohistochemistry-Paraffin: Placental Lactogen/CSH1 Antibody [NBP1-59302] - Human Stomach Tissue, Epithelial cells of funic gland (Indicated with Arrows) 4-8ug/ml.