Name | SLC23A2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59384 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC23A2(solute carrier family 23 (nucleobase transporters), member 2) The peptide sequence was selected from the middle region of SLC23A2. Peptide sequence VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIY |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC23A2 |
Conjugate | Unconjugated |
Supplier Page | Shop |