SLC23A2 Antibody

Name SLC23A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59384
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC23A2(solute carrier family 23 (nucleobase transporters), member 2) The peptide sequence was selected from the middle region of SLC23A2. Peptide sequence VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIY
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC23A2
Conjugate Unconjugated
Supplier Page Shop

Product images