MCM9 Antibody

Name MCM9 Antibody
Supplier Novus Biologicals
Catalog NBP1-58128
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Pig, Bovine, Dog
Antigen Synthetic peptides corresponding to MCM9(minichromosome maintenance complex component 9) The peptide sequence was selected from the N terminal of human MCM9. Peptide sequence NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene MCM9
Supplier Page Shop

Product images