Chymotrypsin-like protease Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58056
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CTRL(chymotrypsin-like) The peptide sequence was selected from the N terminal of CTRL. Peptide sequence LLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CTRL
• Conjugate: Unconjugated

Product images

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: Chymotrypsin-like protease Antibody [NBP1-58056] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.