DNA polymerase delta p50 Antibody
| Name | DNA polymerase delta p50 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58097 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to POLD2(polymerase (DNA directed), delta 2, regulatory subunit 50kDa) The peptide sequence was selected from the N terminal of POLD2. Peptide sequence LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | POLD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DNA polymerase delta p50 Antibody [NBP1-58097] - Human Heart lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16982_DNA-polymerase-delta-p50-Antibody-Western-Blot-NBP1-58097-img0003.jpg)
Western Blot: DNA polymerase delta p50 Antibody [NBP1-58097] - Human Heart lysate, concentration 0.2-1 ug/ml.