KIF19 Antibody

Name KIF19 Antibody
Supplier Novus Biologicals
Catalog NBP1-58168
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FLJ37300 The peptide sequence was selected from the N terminal of FLJ37300. Peptide sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KIF19
Conjugate Unconjugated
Supplier Page Shop

Product images