MSH5 Antibody

Name MSH5 Antibody
Supplier Novus Biologicals
Catalog NBP1-58158
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MSH5(mutS homolog 5 (E. coli)) The peptide sequence was selected from the N terminal of MSH5 (NP_751897). Peptide sequence DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MSH5
Conjugate Unconjugated
Supplier Page Shop

Product images