RAD9B Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58205
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to RAD9B(RAD9 homolog B (S. cerevisiae)) The peptide sequence was selected from the middle region of RAD9B. Peptide sequence SSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEED.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: RAD9B
• Conjugate: Unconjugated

Product images

Western Blot: RAD9B Antibody [NBP1-58205] - Titration: 0.2-1 ug/ml, Positive Control: THP-1 cell lysate.