Apc10 Antibody
| Name | Apc10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58197 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ANAPC10(anaphase promoting complex subunit 10) The peptide sequence was selected from the N terminal of ANAPC10. Peptide sequence MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ANAPC10 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Apc10 Antibody [NBP1-58197] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16445_Apc10%2520Antibody-Western%2520Blot-NBP1-58197-img0003.jpg)
Western Blot: Apc10 Antibody [NBP1-58197] - Titration: 0.2-1 ug/ml, Positive Control: Human Spleen.