| Name | RNASEH2A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58234 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RNASEH2A(ribonuclease H2, subunit A) The peptide sequence was selected from the C terminal of RNASEH2A. Peptide sequence EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RNASEH2A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |