Glutathione S-Transferase mu 1/GSTM1 Antibody
| Name | Glutathione S-Transferase mu 1/GSTM1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58377 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GSTM1(glutathione S-transferase M1) The peptide sequence was selected from the N terminal of GSTM1. Peptide sequence KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GSTM5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GSTM1 Antibody [NBP1-58377] - This Anti-GSTM1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16584_GSTM1%2520Antibody-Western%2520Blot-NBP1-58377-img0001.jpg)
Western Blot: GSTM1 Antibody [NBP1-58377] - This Anti-GSTM1 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.