SLC20A1 Antibody
| Name | SLC20A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59059 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC20A1(solute carrier family 20 (phosphate transporter), member 1) The peptide sequence was selected from the C terminal of SLC20A1. Peptide sequence LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC20A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC20A1 Antibody [NBP1-59059] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16201_SLC20A1%2520Antibody-Western%2520Blot-NBP1-59059-img0002.jpg)
Western Blot: SLC20A1 Antibody [NBP1-59059] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.