Atlastin-3 Antibody

Name Atlastin-3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59034
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DKFZP564J0863 The peptide sequence was selected from the middle region of DKFZP564J0863. Peptide sequence DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ATL3
Conjugate Unconjugated
Supplier Page Shop

Product images