SLC26A1 Antibody
| Name | SLC26A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59408 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC26A1(solute carrier family 26 (sulfate transporter), member 1) The peptide sequence was selected from the C terminal of SLC26A1. Peptide sequence LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC26A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SLC26A1 Antibody [NBP1-59408] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24563_SLC26A1-Antibody-Western-Blot-NBP1-59408-img0001.jpg)
![Immunohistochemistry-Paraffin: SLC26A1 Antibody [NBP1-59408] - Human Skin Tissue Squamous epithelial cells (Indicated with Arrows), 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24564_SLC26A1-Antibody-Immunohistochemistry-Paraffin-NBP1-59408-img0002.jpg)