ARSH Antibody

Name ARSH Antibody
Supplier Novus Biologicals
Catalog NBP1-59370
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARSH(arylsulfatase family, member H) The peptide sequence was selected from the middle region of ARSH. Peptide sequence FIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMVG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARSH
Conjugate Unconjugated
Supplier Page Shop

Product images