SLC39A10 Antibody

Name SLC39A10 Antibody
Supplier Novus Biologicals
Catalog NBP1-59360
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Bovine, Horse, Guinea Pig
Antigen Synthetic peptides corresponding to SLC39A10(solute carrier family 39 (zinc transporter), member 10) The peptide sequence was selected from the N terminal of SLC39A10. Peptide sequence LHRQHRGMTELEPSKFSKQAAENEKKYYIEKLFERYGENGRLSFFGLEKL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC39A10
Supplier Page Shop

Product images