SLC39A7/ZIP7 Antibody

Name SLC39A7/ZIP7 Antibody
Supplier Novus Biologicals
Catalog NBP1-59359
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Pig, Bovine, Sheep
Antigen Synthetic peptides corresponding to SLC39A7(solute carrier family 39 (zinc transporter), member 7) The peptide sequence was selected from the N terminal of SLC39A7. Peptide sequence HDHEHSHGGYGESGAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC39A7
Supplier Page Shop

Product images