SLC41A2 Antibody

Name SLC41A2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59683
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Dog, Horse
Antigen Synthetic peptides corresponding to SLC41A2(solute carrier family 41, member 2) The peptide sequence was selected from the N terminal of SLC41A2. Peptide sequence SCSQKYDDYANYNYCDGRETSETTAMLQDEDISSDGDEDAIVEVTPKLPK.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene SLC41A2
Supplier Page Shop

Product images