Solute carrier family 22 member 18 Antibody
| Name | Solute carrier family 22 member 18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59747 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC22A18(solute carrier family 22, member 18) The peptide sequence was selected from the N terminal of SLC22A18. Peptide sequence AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC22A18 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Solute carrier family 22 member 18 Antibody [NBP1-59747] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6977_Solute%2520carrier%2520family%252022%2520member%252018%2520Antibody-Western%2520Blot-NBP1-59747-img0004.jpg)
![Western Blot: Solute carrier family 22 member 18 Antibody [NBP1-59747] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6978_Solute-carrier-family-22-member-18-Antibody-Western-Blot-NBP1-59747-img0003.jpg)