HERPUD2 Antibody

Name HERPUD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59724
Prices $139.00, $329.00
Sizes 20 µl, 50 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HERPUD2(HERPUD family member 2) The peptide sequence was selected from the N terminal of HERPUD2 (NP_071768). Peptide sequence MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HERPUD2
Conjugate Unconjugated
Supplier Page Shop

Product images