Name | HERPUD2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59724 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 50 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to HERPUD2(HERPUD family member 2) The peptide sequence was selected from the N terminal of HERPUD2 (NP_071768). Peptide sequence MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | HERPUD2 |
Conjugate | Unconjugated |
Supplier Page | Shop |