TMEM57 Antibody
| Name | TMEM57 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59709 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMEM57(transmembrane protein 57) The peptide sequence was selected from the N terminal of TMEM57. Peptide sequence VVWALVLLADFVLEFRFEYLWPFWLFIRSVYDSFRYQGLAFSVFFVCVAF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMEM57 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TMEM57 Antibody [NBP1-59709] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14410_TMEM57-Antibody-Western-Blot-NBP1-59709-img0004.jpg)
Western Blot: TMEM57 Antibody [NBP1-59709] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
![Western Blot: TMEM57 Antibody [NBP1-59709] - MDA-MB-435S cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14411_TMEM57-Antibody-Western-Blot-NBP1-59709-img0002.jpg)
Western Blot: TMEM57 Antibody [NBP1-59709] - MDA-MB-435S cell lysate, concentration 0.2-1 ug/ml.
![Western Blot: TMEM57 Antibody [NBP1-59709] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14412_TMEM57-Antibody-Western-Blot-NBP1-59709-img0003.jpg)
Western Blot: TMEM57 Antibody [NBP1-59709] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
![Western Blot: TMEM57 Antibody [NBP1-59709] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14413_TMEM57%2520Antibody-Western%2520Blot-NBP1-59709-img0005.jpg)
Western Blot: TMEM57 Antibody [NBP1-59709] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.