Name | VNN3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59753 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Rabbit |
Antigen | Synthetic peptides corresponding to VNN3(vanin 3) Antibody(against the N terminal of VNN3. Peptide sequence VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY. |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | VNN3 |
Supplier Page | Shop |