VNN3 Antibody
| Name | VNN3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59753 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to VNN3(vanin 3) Antibody(against the N terminal of VNN3. Peptide sequence VILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAKQGAHIIVTPEDGIY. |
| Purity/Format | Affinity purified |
| Description | Rabbit Polyclonal |
| Gene | VNN3 |
| Supplier Page | Shop |
Product images
![Western Blot: VNN3 Antibody [NBP1-59753] - Human Thymus lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/1938_VNN3-Antibody-Western-Blot-NBP1-59753-img0003.jpg)
Western Blot: VNN3 Antibody [NBP1-59753] - Human Thymus lysate, concentration 0.2-1 ug/ml.