LRRN2 Antibody

Name LRRN2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59796
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LRRN2(leucine rich repeat neuronal 2) The peptide sequence was selected from the middle region of LRRN2. Peptide sequence RVPRRALEQVPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLNNMEELVS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LRRN2
Conjugate Unconjugated
Supplier Page Shop

Product images