Reduced Folate Carrier/SLC19A1 Antibody
| Name | Reduced Folate Carrier/SLC19A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59904 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC19A1(solute carrier family 19 (folate transporter), member 1) The peptide sequence was selected from the N terminal of SLC19A1. Peptide sequence MVPSSPAVEKQVPVEPGPDPELRSWRHLVCYLCFYGFMAQIRPGESFITP. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC19A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25684_Reduced-Folate-Carrier-SLC19A1-Antibody-Western-Blot-NBP1-59904-img0003.jpg)
Western Blot: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Titration: 5.0ug/ml Positive Control: Jurkat cell lysate.
![Immunohistochemistry-Paraffin: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/25685_Reduced-Folate-Carrier-SLC19A1-Antibody-Immunohistochemistry-Paraffin-NBP1-59904-img0002.jpg)
Immunohistochemistry-Paraffin: Reduced Folate Carrier/SLC19A1 Antibody [NBP1-59904] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.