CAT1 Antibody
| Name | CAT1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59857 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-SLC7A1 antibody: synthetic peptide directed towards the N terminal of human SLC7A1. Peptide sequence LGFIMVSGFVKGSVKNWQLTEEDFGNTSGRLCLN |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC7A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: CAT1 Antibody [NBP1-59857] - Reccomended Titration: 1 ug/mL Sample Type: Human MDA-MB-435s](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24906_CAT1%2520Antibody-Western%2520Blot-NBP1-59857-img0004.jpg)
![Western Blot: CAT1 Antibody [NBP1-59857] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24907_CAT1-Antibody-Western-Blot-NBP1-59857-img0002.jpg)
![Western Blot: CAT1 Antibody [NBP1-59857] - Antibody Titration: 1 ug/ml Human 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24908_CAT1-Antibody-Western-Blot-NBP1-59857-img0003.jpg)