NRSN2 Antibody

Name NRSN2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59831
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NRSN2(neurensin 2) The peptide sequence was selected from the middle region of NRSN2. Peptide sequence LLLLLGVAALTTGYAVPPKLEGIGEGEFLVLDQRAADYNQALGTCRLAGT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NRSN2
Conjugate Unconjugated
Supplier Page Shop

Product images