Name | OR2AT4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59861 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to OR2AT4(olfactory receptor, family 2, subfamily AT, member 4) Antibody(against the N terminal of OR2AT4. Peptide sequence MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | OR2AT4 |
Conjugate | Unconjugated |
Supplier Page | Shop |