OR2AT4 Antibody

Name OR2AT4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59861
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR2AT4(olfactory receptor, family 2, subfamily AT, member 4) Antibody(against the N terminal of OR2AT4. Peptide sequence MDATACNESVDGSPVFYLLGIPSLPETFFLPVFFIFLLFYLLILMGNALI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene OR2AT4
Conjugate Unconjugated
Supplier Page Shop

Product images