Glucose Transporter GLUT6 Antibody
| Name | Glucose Transporter GLUT6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59891 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC2A6(solute carrier family 2 (facilitated glucose transporter), member 6) The peptide sequence was selected from the C terminal of SLC2A6. Peptide sequence AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLT |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | SLC2A6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Glucose Transporter GLUT6 Antibody [NBP1-59891] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24668_Glucose-Transporter-GLUT6-Antibody-Western-Blot-NBP1-59891-img0001.jpg)
![Immunohistochemistry-Paraffin: Glucose Transporter GLUT6 Antibody [NBP1-59891] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24669_Glucose-Transporter-GLUT6-Antibody-Immunohistochemistry-Paraffin-NBP1-59891-img0002.jpg)