RNF133 Antibody

Name RNF133 Antibody
Supplier Novus Biologicals
Catalog NBP1-62487
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNF133(ring finger protein 133) The peptide sequence was selected from the N terminal of RNF133. Peptide sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVIVPPEGKIQNA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNF133
Conjugate Unconjugated
Supplier Page Shop

Product images