Name | TMEM24 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62475 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog |
Antigen | Synthetic peptides corresponding to TMEM24 The peptide sequence was selected from the C terminal of TMEM24. Peptide sequence AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | C2CD2L |
Supplier Page | Shop |