Name | BRI3BP Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62385 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to BRI3BP(BRI3 binding protein) The peptide sequence was selected from the C terminal of BRI3BP. Peptide sequence GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | BRI3BP |
Supplier Page | Shop |