BRI3BP Antibody

Name BRI3BP Antibody
Supplier Novus Biologicals
Catalog NBP1-62385
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to BRI3BP(BRI3 binding protein) The peptide sequence was selected from the C terminal of BRI3BP. Peptide sequence GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene BRI3BP
Supplier Page Shop

Product images