SLC22A13 Antibody

Name SLC22A13 Antibody
Supplier Novus Biologicals
Catalog NBP1-62520
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC22A13(solute carrier family 22, member 13) The peptide sequence was selected from the N terminal of SLC22A13. Peptide sequence FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC22A13
Conjugate Unconjugated
Supplier Page Shop

Product images