TSPAN32/TSSC6 Antibody
| Name | TSPAN32/TSSC6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62646 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TSPAN32(tetraspanin 32) The peptide sequence was selected from the middle region of TSPAN32. Peptide sequence YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | TSPAN32 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TSPAN32/TSSC6 Antibody [NBP1-62646] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24280_TSPAN32-TSSC6-Antibody-Western-Blot-NBP1-62646-img0001.jpg)
Western Blot: TSPAN32/TSSC6 Antibody [NBP1-62646] - Jurkat cell lysate, Antibody Titration: 5.0ug/ml
![Immunohistochemistry-Paraffin: TSPAN32/TSSC6 Antibody [NBP1-62646] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24281_TSPAN32-TSSC6-Antibody-Immunohistochemistry-Paraffin-NBP1-62646-img0003.jpg)
Immunohistochemistry-Paraffin: TSPAN32/TSSC6 Antibody [NBP1-62646] - Human Liver Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Hepatocytes (indicated with arrows) 400X magnification.