ST3GAL3 Antibody

Name ST3GAL3 Antibody
Supplier Novus Biologicals
Catalog NBP1-62554
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ST3GAL3(ST3 beta-galactoside alpha-2,3-sialyltransferase 3) The peptide sequence was selected from the N terminal of ST3GAL3. Peptide sequence MTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ST3GAL3
Conjugate Unconjugated
Supplier Page Shop

Product images