MGC4172 Antibody

Name MGC4172 Antibody
Supplier Novus Biologicals
Catalog NBP1-60061
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MGC4172(short-chain dehydrogenase/reductase) The peptide sequence was selected from the C terminal of MGC4172. Peptide sequence VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DHRS11
Conjugate Unconjugated
Supplier Page Shop

Product images