FAM134C Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-60104
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to FAM134C(family with sequence similarity 134, member C) The peptide sequence was selected from the N terminal of FAM134C. Peptide sequence EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: FAM134C
• Conjugate: Unconjugated