ZDHHC24 Antibody

Name ZDHHC24 Antibody
Supplier Novus Biologicals
Catalog NBP1-60079
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ZDHHC24(zinc finger, DHHC-type containing 24) The peptide sequence was selected from the N terminal of ZDHHC24 (NP_997223). Peptide sequence YVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVML.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZDHHC24
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.