Connexin 30/GJB6 Antibody

Name Connexin 30/GJB6 Antibody
Supplier Novus Biologicals
Catalog NBP1-59193
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GJB6(gap junction protein, beta 6, 30kDa) The peptide sequence was selected from the middle region of GJB6. Peptide sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene GJB6
Conjugate Unconjugated
Supplier Page Shop

Product images