Name | GJD3 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59160 |
Prices | $299.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Dog |
Antigen | Synthetic peptides corresponding to GJC1 (gap junction protein, chi 1, 31.9kDa) The peptide sequence was selected from the N terminal of GJC1. Peptide sequence IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF. |
Purity/Format | IgG purified |
Description | Rabbit Polyclonal |
Gene | GJD3 |
Supplier Page | Shop |