GJD3 Antibody

Name GJD3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59160
Prices $299.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog
Antigen Synthetic peptides corresponding to GJC1 (gap junction protein, chi 1, 31.9kDa) The peptide sequence was selected from the N terminal of GJC1. Peptide sequence IFRILVLATVGGAVFEDEQEEFVCNTLQPGCRQTCYDRAFPVSHYRFWLF.
Purity/Format IgG purified
Description Rabbit Polyclonal
Gene GJD3
Supplier Page Shop

Product images