Claudin-15 Antibody

Name Claudin-15 Antibody
Supplier Novus Biologicals
Catalog NBP1-59267
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLDN15(claudin 15) The peptide sequence was selected from the middle region of CLDN15. Peptide sequence LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLDN15
Conjugate Unconjugated
Supplier Page Shop

Product images