PCDHA12 Antibody

Name PCDHA12 Antibody
Supplier Novus Biologicals
Catalog NBP1-59252
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCDHA12(protocadherin alpha 12) The peptide sequence was selected from the N terminal of PCDHA12. Peptide sequence EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCDHA12
Conjugate Unconjugated
Supplier Page Shop

Product images