ROM1 Antibody

Name ROM1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59202
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ROM1(retinal outer segment membrane protein 1) The peptide sequence was selected from the middle region of ROM1. Peptide sequence NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ROM1
Conjugate Unconjugated
Supplier Page Shop

Product images