Connexin 46/GJA3 Antibody
| Name | Connexin 46/GJA3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59197 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GJA3(gap junction protein, alpha 3, 46kDa) The peptide sequence was selected from the N terminal of GJA3. Peptide sequence ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GJA3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Connexin 46/GJA3 Antibody [NBP1-59197] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16698_Connexin-46-GJA3-Antibody-Western-Blot-NBP1-59197-img0003.jpg)
Western Blot: Connexin 46/GJA3 Antibody [NBP1-59197] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.