FJX1 Antibody

Name FJX1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59470
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FJX1(four jointed box 1 (Drosophila)) The peptide sequence was selected from the N terminal of FJX1. Peptide sequence MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FJX1
Conjugate Unconjugated
Supplier Page Shop

Product images