Hsp40/DNAJC25 Antibody

Name Hsp40/DNAJC25 Antibody
Supplier Novus Biologicals
Catalog NBP1-59433
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to Hsp40/DNAJC25 (DnaJ (Hsp40) homolog, subfamily C, member 25) The peptide sequence was selected from the middle region of Hsp40/DNAJC25. Peptide sequence RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DNAJC25
Conjugate Unconjugated
Supplier Page Shop

Product images